International Conference on Information Processing in Sensor Networks - PDFSEARCH.IO - Document Search Engine

International Conference on Information Processing in Sensor Networks
Results: 60

#	Item
41	International Plant Sentinel Network Formal Agreement The International Plant Sentinel Network (IPSN) is a 3 year funded project which aims to provide a mechanism for botanic gardens and arboreta to contribute to global Add to Reading List Source URL: www.plantsentinel.org Language: English - Date: 2014-04-03 10:49:22 International Conference on Information Processing in Sensor Networks Wireless sensor network Agronomy Botanic Gardens Conservation International Plant pathology Arboretum Botanical gardens Biology Botany
42	Establishing the basis for an International Plant Sentinel Network as an earlywarning system for future pest threats (IPSN) Picture 1 Add to Reading List Source URL: www.euphresco.net Language: English - Date: 2014-09-18 06:34:34 Pest International Conference on Information Processing in Sensor Networks Botany Biology Botanical garden Herbals Plant taxonomy
43	Scanning the Issue Special Issue on Sensor Networks and Applications Microsensor network technology will have a significant impact on our lives in the 21st century. Microsensor devices, ranging in size from cubic inches Add to Reading List Source URL: w3.antd.nist.gov Language: English - Date: 2009-02-03 16:25:15 Computing Wireless sensor network Wireless ad-hoc network Mobile ad hoc network Sensor node Institute of Electrical and Electronics Engineers International Conference on Information Processing in Sensor Networks Sensor web Wireless networking Technology Telecommunications engineering
44	Kamin Whitehouse 501 Rice Hall • Charlottesville, VA[removed]removed] • ([removed]HIGHLIGHTS Commonwealth endowed chair Add to Reading List Source URL: www.cs.virginia.edu Language: English - Date: 2014-09-20 21:11:12 Technology Conference on Embedded Networked Sensor Systems International Conference on Information Processing in Sensor Networks International nongovernmental organizations Computer science Association for Computing Machinery Carlo Ghezzi Ubiquitous computing Year of birth missing Wireless sensor network Wireless networking Computing
45	Realistic Case Studies of Wireless Structural Control Bo Li1 , Zhuoxiong Sun2 , Kirill Mechitov3 , Gregory Hackmann1 , Chenyang Lu1 , Shirley J. Dyke2 , Gul Agha3 , Billie F. Spencer Jr.4 1 Department of Computer Scienc Add to Reading List Source URL: www.cse.wustl.edu Language: English - Date: 2013-03-12 12:15:38 Telecommunications engineering Sensor node Cyber-physical system Structural health monitoring ANT Wireless bridge International Conference on Information Processing in Sensor Networks Wireless sensor network Technology Computing
46	SenSys 2013 November 11-15, 2013 Rome, Italy The 11th ACM Conference on Add to Reading List Source URL: sensys.acm.org Language: English - Date: 2012-11-07 14:15:40 Conference on Embedded Networked Sensor Systems Computing Telecommunications engineering Cyber-physical system Geographic information system Body area network International Conference on Information Processing in Sensor Networks Wireless sensor network Technology Wireless networking
47	Indiana School of Informatics Lindley Hall Bloomington, IN[removed]email username: rrnewton email domain: indiana.edu Add to Reading List Source URL: www.cs.indiana.edu Language: English - Date: 2014-01-15 17:51:40 Functional programming Wireless sensor network Programming paradigms Functional languages International Conference on Functional Programming International Conference on Information Processing in Sensor Networks Haskell Actor model Intel Concurrent Collections Computing Software engineering Computer programming
48	International Plant Sentinel Network Formal Agreement The International Plant Sentinel Network (IPSN) is a 3 year funded project which aims to provide a mechanism for botanic gardens and arboreta to contribute to global Add to Reading List Source URL: www.bgci.org Language: English - Date: 2014-04-03 10:49:22 International Conference on Information Processing in Sensor Networks Wireless sensor network Agronomy Botanic Gardens Conservation International Plant pathology Arboretum Botanical gardens Biology Botany
49	Experiments in Instrumenting Wireless Sensor Networks for Real-Time Surveillance Phoebus Chen∗ , Songhwai Oh∗ , Michael Manzo∗ , Bruno Sinopoli∗ , Cory Sharp† , Kamin Whitehouse∗ , Gilman Tolle∗‡ , Jaein Add to Reading List Source URL: www.cs.berkeley.edu Language: English - Date: 2006-03-02 20:22:14 Telecommunications engineering International Conference on Information Processing in Sensor Networks Sensor node Sensor fusion Conference on Embedded Networked Sensor Systems ANT Motion detector Virtual sensor network Wireless sensor network Technology Computing
50	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions &0DQDJHPHQWRIVFLHQWLILFFRPPLWWHHVVFLHQWLILFFRRSHUDWLRQDQGQHWZRUNV 6&,(17,),&&200,77((213/$176 Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:32:12 Soil Leachate Environment Sustainability Earth Land management International Conference on Information Processing in Sensor Networks Wireless sensor network